PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 872430
Common NameARALYDRAFT_671874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 206aa    MW: 23889.1 Da    PI: 9.4123
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
872430genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-0781125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W +e +e ++ + k++G++ W++Ia  ++  + +kq+  + ++y
           872430  81 RTKWNKETHEWFLIGLKRFGKD-WRKIAVLLN-SKNPKQVEIYAHNY 125
                      689*****************99.*********.*******9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.586152IPR017884SANT domain
SMARTSM007170.0089253IPR001005SANT/Myb domain
SuperFamilySSF466892.39E-8457IPR009057Homeodomain-like
SuperFamilySSF466896.21E-875127IPR009057Homeodomain-like
PROSITE profilePS5129410.33576130IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-579130IPR009057Homeodomain-like
SMARTSM007171.1E-480128IPR001005SANT/Myb domain
PfamPF002492.0E-581125IPR001005SANT/Myb domain
CDDcd001673.54E-483126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MAETSWTREE NEKFKNALVL FSAFLPTRFQ IIAENVQKSV ADVKEHYKEM VNDLLERGSS  60
RVAFPNKLTE AMAQRSYQAE RTKWNKETHE WFLIGLKRFG KDWRKIAVLL NSKNPKQVEI  120
YAHNYFNWQS SEENVMKRPR ANDITVENTE VNVMKRQRAN DMVDTNVGST GQQESLVVHP  180
QPQHEPIVMQ ICHHAKASNS KCINN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884801.11e-154predicted protein
TrEMBLD7L9131e-154D7L913_ARALL; Predicted protein
STRINGAl_scaffold_0003_10711e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15934911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-30MYB family protein